| Sequence 1: | NP_788526.1 | Gene: | CG18135 / 40073 | FlyBaseID: | FBgn0036837 | Length: | 770 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_506439.1 | Gene: | T22G5.1 / 179882 | WormBaseID: | WBGene00011929 | Length: | 325 | Species: | Caenorhabditis elegans |
| Alignment Length: | 130 | Identity: | 32/130 - (24%) |
|---|---|---|---|
| Similarity: | 53/130 - (40%) | Gaps: | 43/130 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 457 GHRGNGKSYIADAPAERENTIASFLSAHEHHADMIELDVHLTADGVPVIYHDFG-LRTAPPGKQI 520
Fly 521 SRPDQLEY--------------------------VL----IKDINYELLKRLRIFSVIAGQVREY 555
Fly 556 555 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18135 | NP_788526.1 | CBM20_Prei4 | 166..288 | CDD:99888 | |
| GDPD_GDE5 | 454..741 | CDD:176549 | 32/130 (25%) | ||
| T22G5.1 | NP_506439.1 | PI-PLCc_GDPD_SF | 70..320 | CDD:472694 | 32/130 (25%) |
| Blue background indicates that the domain is not in the aligned region. | |||||