DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18135 and LOC100334642

DIOPT Version :9

Sequence 1:NP_788526.1 Gene:CG18135 / 40073 FlyBaseID:FBgn0036837 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_002661335.4 Gene:LOC100334642 / 100334642 -ID:- Length:393 Species:Danio rerio


Alignment Length:219 Identity:43/219 - (19%)
Similarity:81/219 - (36%) Gaps:58/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 LQSCRQLEYRYFVYVEDLSGYKQIRRWETHFKPRSLGPCTELQCSQLDVFGIT--SDNSDLKPQV 283
            |.|.::|...|    :|..|:..:..       .:|...|||....|:...:.  .|::.::|..
Zfish    11 LGSTKRLNINY----QDPDGFSSLHH-------AALTGTTELLSLLLEAQAVVDIKDSNGMRPLH 64

  Fly   284 HRGWLNH-EAILQLKFNGEKMFQV-HDIETFDPQHVQLKIVPVEKTAGLHVEYSKQEYGKSQLEL 346
            :..|... :::|.|..:|..:... ||                               |:..|.|
Zfish    65 YAAWQGKADSVLMLLRSGAAVNSASHD-------------------------------GQIPLHL 98

  Fly   347 QPTFGVPYTKGDIVIFHITLP--LERMMEQHFRLEC---YSMSNELLGSATLVTSDLTG-----S 401
            ...:| .|...::::.|.:.|  |.:..:....|.|   .:...:||.|:.:|.|.|.|     |
Zfish    99 AAQYG-HYEVSEMLLQHQSNPCVLNKAKKTPLDLACEFGRAKVAQLLLSSNMVASLLEGDRRDAS 162

  Fly   402 EGVLHLPIK-SAKNADETLARLRL 424
            :...:.|:. :|:|..:.:.||.|
Zfish   163 DSNCNTPLHLAARNGHKDVIRLLL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18135NP_788526.1 CBM20_Prei4 166..288 CDD:99888 13/68 (19%)
GDPD_GDE5 454..741 CDD:176549
GDPD 458..744 CDD:281062
LOC100334642XP_002661335.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D687958at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.