DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11619 and Gde1

DIOPT Version :10

Sequence 1:NP_649081.1 Gene:CG11619 / 40072 FlyBaseID:FBgn0036836 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_116004.2 Gene:Gde1 / 60418 RGDID:621788 Length:331 Species:Rattus norvegicus


Alignment Length:191 Identity:49/191 - (25%)
Similarity:72/191 - (37%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 VVQPMPKVEAGNLRASFHHYWPDNWPTLDVGYRGLGASYFQSSTSLTENTIESYLAVLKAKGDMV 398
            |::|..:|.|                   :.:||       .|....|||:.:.....|.....|
  Rat    58 VLKPRDRVSA-------------------IAHRG-------GSHDAPENTLAAIRQAAKNGATGV 96

  Fly   399 QLDVQLTKDYVPVVWHGFGFYTSD--TDRSVRDRFDLRFVLIRELTYSELKASRVFILKRWTVQE 461
            :||::.|.|.|||:.|.   .|.|  ||.|.| ..||.|..:|:|..:                 
  Rat    97 ELDIEFTSDGVPVLMHD---NTVDRTTDGSGR-LCDLTFEQVRKLNPA----------------- 140

  Fly   462 YTNLNVKDVSQKHRIFPKLSE-VFEALPKTLGLLVEIKWPQIMASGVPESTQSLNKNIYVD 521
             .|..:::.....|| |.|.| |.|.|...|.:..::|....|||       :..||||::
  Rat   141 -ANHRLRNEFPDERI-PTLREAVTECLCHNLTIFFDVKGHADMAS-------AALKNIYME 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11619NP_649081.1 CBM20_Prei4 69..196 CDD:99888
GDPD_GDE5 361..648 CDD:176549 45/164 (27%)
Gde1NP_116004.2 GDPD_GDE1 68..323 CDD:176515 45/162 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.