DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC16 and u2af2

DIOPT Version :9

Sequence 1:NP_001335293.2 Gene:SIGLEC16 / 400709 HGNCID:24851 Length:481 Species:Homo sapiens
Sequence 2:NP_001016998.1 Gene:u2af2 / 549752 XenbaseID:XB-GENE-494184 Length:465 Species:Xenopus tropicalis


Alignment Length:135 Identity:27/135 - (20%)
Similarity:42/135 - (31%) Gaps:51/135 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    63 KGWTSPKTGAPVATNNQSREVEMS------------TRDRFQLTGDPGKGSCSLVIRDAQR---- 111
            |.|..|..|....|..|.:.::.:            |.|...:|..|.....|.:.|.|:|    
 Frog    75 KYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVG 139

Human   112 -------EDEAWYFFRVERGSRVRHSFVNNLFFLKVTALTQKPDVYIPETLEPGQPVTVICV--- 166
                   |:....||..:               :::..|||          .||.||..:.:   
 Frog   140 NIPFGITEEAMMDFFNAQ---------------MRLGGLTQ----------APGNPVLAVQINQD 179

Human   167 FNWAF 171
            .|:||
 Frog   180 KNFAF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC16NP_001335293.2 Ig_Siglec_N 22..141 CDD:143189 17/100 (17%)
IG_like 247..323 CDD:214653
IG_like 350..425 CDD:214653
u2af2NP_001016998.1 U2AF_lg 4..464 CDD:273727 27/135 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I35468
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I12170
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm54708
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.