DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIGLEC16 and igcm-1

DIOPT Version :9

Sequence 1:NP_001335293.2 Gene:SIGLEC16 / 400709 HGNCID:24851 Length:481 Species:Homo sapiens
Sequence 2:NP_508166.1 Gene:igcm-1 / 180433 WormBaseID:WBGene00018215 Length:1073 Species:Caenorhabditis elegans


Alignment Length:562 Identity:110/562 - (19%)
Similarity:190/562 - (33%) Gaps:208/562 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    18 KDPS---YSLQVQRQVPVPEGLCVIVSCNLS---YPRDGWDESTAAYGYWFKGWTSPKTGAPVAT 76
            |:||   |.||...     ||  :::.|.:.   :.|..::.:.|.|                 .
 Worm    29 KEPSSEPYFLQEGN-----EG--IVIPCVVKPEYFDRQKYEINWARY-----------------N 69

Human    77 NNQSREVEMSTR------DRFQLTGDPGKGSCSLVIRDAQRED-EAWYFFRV--ERGSRVRHSFV 132
            |.|.|.:..:.:      .||.|..|...|:.||.|.:.::.. |..|...|  ...|.|::|.:
 Worm    70 NGQLRMITKNDKLLAKKHSRFILENDSATGNYSLRITEVEKNSVEGTYHCNVIGTDDSDVQYSAL 134

Human   133 NNLFFLKVTALTQKPDVYI----PETLEPGQPVTVICVFNWAFKKCPAPSFSWTGAALSPRRTRP 193
                 ..|..|....|..|    .|::..|..:|..||   :....|.|:|:||    .|..|..
 Worm   135 -----ATVVVLVPPGDPIISTTPSESVIEGDFMTAKCV---SVGGSPQPTFTWT----LPNDTIA 187

Human   194 STSHF----------SVLSFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRVASLEL-------- 240
            |::.|          |:|.|..:..|....:.|  |.:.:.:....|.:::.:.|.:        
 Worm   188 SSAIFTTQFRDGATESLLHFRVTSSDDGKSVQC--DVTNRAMLGGETKQVKSSQLNVLYKPVVFV 250

Human   241 --QGNVIYLEVQKGQFLRLLCAADSQPPATLSWVLQDRVLSSSHPWGPRTLGLELRG------VR 297
              ..|:.:|.|::|:.:.|.|.:.|.|||            .|:.|.....|...:|      |.
 Worm   251 TPTENLTHLSVEEGELVNLTCNSASNPPA------------HSYEWKHIASGERYQGKIWPIRVD 303

Human   298 AGDSGRYTCRAENRLGSQQRALDLSVQYPP-------------ENLRVM---------------- 333
            :..||.:.||:.|.||.....|.:.||:.|             |::.::                
 Worm   304 SSMSGDFECRSTNELGEGTAVLKMVVQHIPRINVPESISPNEMEDIDILCEVSAVPEVIDIKWVG 368

Human   334 ---------------VSQA---NRTVL------------ENLRNGTSLRVLE------------- 355
                           :|:|   |.|.:            ...|.||...:::             
 Worm   369 PNGFKQNGSRLTITSISKAQSGNYTCMATNFLTVYGHSGSQQRMGTGTTIVDVKRKPGQAQIVSA 433

Human   356 ------GQSLRLVCVTH--SSPPARLSWTRWGQTVGPSQPSDPGV----------LELPRVQMEH 402
                  |::::|:|...  .:|.|..:|         :.||..|:          .|:...|:..
 Worm   434 RQNVDVGETIKLMCQAEDAGNPSASYTW---------ASPSSGGIFGLEGHTEKSFEVRNAQLSD 489

Human   403 EGEFTCHARHPLGSQRVSLSFSVHCKSGPMTGVVLVAVGEVA 444
            .|.::|.|.:.||..::              |.|::.|.|.|
 Worm   490 NGVYSCKAYNDLGEGKI--------------GTVMITVIEKA 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIGLEC16NP_001335293.2 Ig_Siglec_N 22..141 CDD:143189 26/130 (20%)
IG_like 247..323 CDD:214653 22/81 (27%)
IG_like 350..425 CDD:214653 16/105 (15%)
igcm-1NP_508166.1 Ig 45..119 CDD:299845 17/90 (19%)
Ig 146..226 CDD:299845 21/88 (24%)
Ig_3 245..316 CDD:290638 19/82 (23%)
IG_like 258..329 CDD:214653 22/82 (27%)
IG_like 338..398 CDD:214653 5/59 (8%)
IGc2 347..398 CDD:197706 5/50 (10%)
Ig_2 429..513 CDD:290606 18/106 (17%)
IG_like 437..513 CDD:214653 18/98 (18%)
Ig 537..615 CDD:143165
IG_like 644..728 CDD:214653
IGc2 646..719 CDD:197706
FN3 733..843 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.