DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and HFL1

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_012977.3 Gene:HFL1 / 853925 SGDID:S000001759 Length:418 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:63/299 - (21%)
Similarity:107/299 - (35%) Gaps:104/299 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SIFATTVS--RLRRHL---DKPL-LGPSIMMVGLYPIISVAALVTILVP-------------YSW 108
            ||.||.:|  .:.|||   .||. ...||.::.|.||.||:....|:.|             |..
Yeast    18 SIIATIISFYTITRHLLNYRKPYEQRLSIRILLLVPIFSVSCASGIIKPEAAQFYVDPIREFYEA 82

  Fly   109 FICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKL 173
            |:.:|            |.|.|...:|.|:|.:     ..:.||..|       ....||...|:
Yeast    83 FVIYT------------FFTFLTLLLGGERNII-----TVLSLNHAP-------TRHPIPLIGKI 123

  Fly   174 C-----------------ISRYMVWQMPFW-QGSIM----------LVMNILYYRDIQLYRQVMF 210
            |                 |.:| ||..||: .|:::          :.:|:.|.           
Yeast   124 CKPIDLSDPFDFLFVKKGILQY-VWFKPFYCFGTLICSAWKLPKFEIFLNVFYN----------- 176

  Fly   211 FFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGG 275
                   .|:....:||.:..:.:......|:...|..|::|::.....|.::    :.|:.:.|
Yeast   177 -------ISVTWSLYSLALFWKCLYPELTPYKPWLKFLCVKLIIFASYWQSII----IQGLVVTG 230

  Fly   276 EYPINHT------VYKQTIINILILVEMVLVSMMVQSAY 308
            :....:.      |||    |.|:.:|||..:::...|:
Yeast   231 KLGTGNQDRTSGYVYK----NGLLCIEMVPFAILHAVAF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 63/299 (21%)
HFL1NP_012977.3 Solute_trans_a 14..267 CDD:397604 63/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.