DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and AT1G77220

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_565152.1 Gene:AT1G77220 / 844058 AraportID:AT1G77220 Length:484 Species:Arabidopsis thaliana


Alignment Length:288 Identity:56/288 - (19%)
Similarity:102/288 - (35%) Gaps:55/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LSLAIFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFIC 111
            ||.::|:...:.:....||....|..:....|.|:| .|:||   |:.:|.:.::::...:.|.|
plant    44 LSASVFVVIAILLPMYLIFEHLASYNQPEEQKFLIG-LILMV---PVYAVESFLSLVNSEAAFNC 104

  Fly   112 HTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCIS 176
            ..:...........|...|...:..|:..::....:.|             :....|.....|  
plant   105 EVIRDCYEAFALYCFERYLIACLDGEERTIEFMEQQTV-------------ITQSTPLLEGTC-- 154

  Fly   177 RYMVWQMPFWQGSIMLVMNILYYRD----IQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKV 237
            .|.|.:.||       .|| .:.:|    .|.|..|....:.:::..::..      .:.||.:.
plant   155 SYGVVEHPF-------PMN-CFVKDWSLGPQFYHAVKIGIVQYMILKMICA------LLAMILEA 205

  Fly   238 RGDY------------QLRKKMFCLQLVVMLCKLQ-YLVLYDQLDGIKMGGEY----PINHTVYK 285
            .|.|            .|...:...|...:.|.:| |.|:.|:|..||...::    .|....:.
plant   206 FGVYGEGKFAWNYGYPYLAVVLNFSQTWALYCLVQFYNVIKDKLAPIKPLAKFLTFKSIVFLTWW 270

  Fly   286 QTIINILILVEMVLVSMMVQSAYRTPVQ 313
            |.|| :..|..|.||...:....:|.:|
plant   271 QGII-VAFLFSMGLVKGSLAKELKTRIQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 52/279 (19%)
AT1G77220NP_565152.1 Solute_trans_a 43..320 CDD:397604 56/288 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.