DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and AT1G23070

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_173720.3 Gene:AT1G23070 / 838915 AraportID:AT1G23070 Length:403 Species:Arabidopsis thaliana


Alignment Length:255 Identity:50/255 - (19%)
Similarity:83/255 - (32%) Gaps:99/255 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HLDKPLLGPSIMMV----GLYPIISVAALVTILVPYSWFICHTVMHVMFMVGGPVFRT------- 128
            ||...::|.|...|    .||.|:......|......|     ::.|:|||  ||:.|       
plant    13 HLPSLIIGGSFATVAICLSLYSILQHLRFYTNPAEQKW-----IVSVLFMV--PVYATESIISLS 70

  Fly   129 -------------------------LLFRYVGSEQNYV------------KETAGEAVQLNTPPC 156
                                     .|...:|.|:..|            :|.|.|:.:......
plant    71 NSKFSLPCDILRNCYEAFALYSFGSYLVACLGGERRVVEYLENESKKPLLEEGANESKKKKKKNS 135

  Fly   157 CCCCLCLPMVIPTK----AKLCISRYMVWQMPFWQGSIMLVMNIL-YYRDIQLYRQVMFFFIPFI 216
            ....||.|.|:..:    .|..:.:||:  :..:...:..::.:| .|.|.:.   ..::..|:|
plant   136 FWKFLCDPYVLGRELFVIEKFGLVQYMI--LKTFCAFLTFLLELLGVYGDGEF---KWYYGYPYI 195

  Fly   217 VCSIVLG---AWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQ-YLVLYDQLDGIK 272
            |  :||.   .|:|                    |||        :| |.|.:::|..||
plant   196 V--VVLNFSQMWAL--------------------FCL--------VQFYNVTHERLKEIK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 50/255 (20%)
AT1G23070NP_173720.3 Solute_trans_a 17..290 CDD:397604 48/251 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.