DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and AT1G11200

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_563884.1 Gene:AT1G11200 / 837661 AraportID:AT1G11200 Length:295 Species:Arabidopsis thaliana


Alignment Length:313 Identity:57/313 - (18%)
Similarity:117/313 - (37%) Gaps:89/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LSLAIFIASLLTILNISIFAT------TVSRLRRHL---DKPLLGPSIMMVGLY-PIISVAALVT 101
            :.|:....:.:|::. |:|..      |:..:.:||   .||....:|:::.|. |:.::.:.|.
plant     2 IDLSTLSPAEITVMG-SVFCVLLSMHFTMQLVSQHLFYWKKPNEQRAILIIVLMAPVYAINSFVG 65

  Fly   102 IL-----VPYSWFI-----CHTVMHVMFMVGGPVFRTLLFRYVG---SEQNYVKETAGEAVQLNT 153
            :|     .|:..|:     |:..:.:      ..|..|::.||.   |.:....|..|..:..:.
plant    66 LLDAKGSKPFFMFLDAVKECYEALVI------AKFLALMYSYVNISMSARIIPDEFKGREIHHSF 124

  Fly   154 PPCCCCCLCLPMVIPTKAK---LCISRYMVWQMPFWQ--------GSIMLVMNILYYRDIQLYRQ 207
            |        :.:.:|....   |.:.:...|.   ||        ..:|:.:.||....:.|   
plant   125 P--------MTLFVPRTTHLDYLTLKQLKQWT---WQFCIIRPVCSILMITLQILGIYPVWL--- 175

  Fly   208 VMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVL-------- 264
             .:.|...:..|:.|..:||.....:..|....::...|..|::.:|..|..|.:||        
plant   176 -SWIFTAILNVSVSLALYSLVKFYHVFAKELEPHKPLTKFMCVKGIVFFCFWQGIVLKILVGLGL 239

  Fly   265 ---------YDQLDGIKMGGEYPINHTVYKQTIINILILVEMVLVSMMVQSAY 308
                     .|||:                :.:.|:|:.:||::.|::.|.|:
plant   240 IKSHHFWLEVDQLE----------------EALQNVLVCLEMIVFSIIQQYAF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 56/310 (18%)
AT1G11200NP_563884.1 Solute_trans_a 17..280 CDD:281602 55/297 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.