DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and AT5G26740

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001078625.1 Gene:AT5G26740 / 832714 AraportID:AT5G26740 Length:422 Species:Arabidopsis thaliana


Alignment Length:318 Identity:57/318 - (17%)
Similarity:110/318 - (34%) Gaps:94/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YYENMTAFLSLAIFIASLLTILNISIFATTVSRLRRHL---DKPLLGPSIM-MVGLYPIISVAAL 99
            :|.|:.|||            ..:...|..:..:.|||   .:|.....|: ::.:.|:.:..:.
plant     7 FYLNIVAFL------------CTVGAIALAIFHIYRHLLNYTEPTYQRYIVRIIFMVPVYAFMSF 59

  Fly   100 VTILVPYS-------------WFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQL 151
            :::::|.|             |.|.:             |.:|...:||...:.|...:|.:::.
plant    60 LSLVLPKSSIYFDSIREVYEAWVIYN-------------FLSLCLAWVGGPGSVVLSLSGRSLKP 111

  Fly   152 NTPPCCCC-------------CL--CLPMVIPTKAKLCISRYMVWQMPFWQGSI-----MLVMNI 196
            :.....||             |.  ||..||.....:.::..:..:..:..|:.     .|.:.|
plant   112 SWSLMTCCFPPLTLDGRFIRRCKQGCLQFVILKPILVAVTLVLYAKGKYKDGNFNPDQAYLYLTI 176

  Fly   197 LY---YRDIQLYRQVMFFFI------PF-------IVCSIV-LGAWS-----LQITVRMITKVRG 239
            :|   | .:.||..|:|:..      ||       |:.|:| |..|.     |......|.....
plant   177 IYTISY-TVALYALVLFYMACRDLLQPFNPVPKFVIIKSVVFLTYWQGVLVFLAAKSGFIKSAEA 240

  Fly   240 DYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGG----EYPINHTV-----YKQTI 288
            ....:..:.|:::::......|...|.:..|..:||    ...::|.|     |..|:
plant   241 AAHFQNFIICVEMLIAAACHFYAFPYKEYAGANVGGSGSFSGSLSHAVKLNDFYHDTV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 52/307 (17%)
AT5G26740NP_001078625.1 Solute_trans_a 11..268 CDD:397604 48/282 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.