powered by:
Protein Alignment CG6836 and LAZ1
DIOPT Version :9
Sequence 1: | NP_649079.2 |
Gene: | CG6836 / 40070 |
FlyBaseID: | FBgn0036834 |
Length: | 328 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_974706.1 |
Gene: | LAZ1 / 829993 |
AraportID: | AT4G38360 |
Length: | 485 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 28/56 - (50%) |
Gaps: | 7/56 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 AFLSLAIFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALV 100
|||.|.:.::..|...::|.:.....: |.|:| .|:||..|.|.|.|:||
plant 26 AFLVLTLSLSLFLVFDHLSTYKNPEEQ------KFLIG-VILMVPCYSIESFASLV 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2641 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.