DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and TMEM184C

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_060711.2 Gene:TMEM184C / 55751 HGNCID:25587 Length:438 Species:Homo sapiens


Alignment Length:287 Identity:56/287 - (19%)
Similarity:107/287 - (37%) Gaps:95/287 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AIFIASLLTILNISIFATTVSRLRRHLDKP-LLGPSIMMVGLYPIISVAALVTILVP-------- 105
            |.|||.:..:|.|.|....:.:...|..:| |..|.|.::.:.||.|:.:.:.:..|        
Human    48 AWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDT 112

  Fly   106 ----YSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMV 166
                |..::.:..|       |.:...|..||    .|.|.....:..|.:.||.|||       
Human   113 CRECYEAYVIYNFM-------GFLTNYLTNRY----PNLVLILEAKDQQKHFPPLCCC------- 159

  Fly   167 IPTKAKLCISRYMVWQMPFW-QGSIMLV---MNILYYRDIQLYRQVMFFFIPFIVCSIVLG---- 223
                             |.| .|.::|.   :.:|.|..::     .|..|..::|.: ||    
Human   160 -----------------PPWAMGEVLLFRCKLGVLQYTVVR-----PFTTIVALICEL-LGIYDE 201

  Fly   224 -------AWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINH 281
                   ||:..:.:..::::..       |:||.|.       |.||.::|..|:..|::    
Human   202 GNFSFSNAWTYLVIINNMSQLFA-------MYCLLLF-------YKVLKEELSPIQPVGKF---- 248

  Fly   282 TVYKQTIINILILV---EMVLVSMMVQ 305
                 ..:.:::.|   :.|:::::|:
Human   249 -----LCVKLVVFVSFWQAVVIALLVK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 56/287 (20%)
TMEM184CNP_060711.2 Solute_trans_a 50..316 CDD:308940 55/285 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..438
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.