DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and tmem184ba

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_005156201.1 Gene:tmem184ba / 550413 ZFINID:ZDB-GENE-050417-219 Length:426 Species:Danio rerio


Alignment Length:305 Identity:59/305 - (19%)
Similarity:101/305 - (33%) Gaps:100/305 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFIASLLTILNISIFATTVS--RLRRHLDKPLLGPSIMMVGLYPIISVAALV------------T 101
            ::.|.|||...|.:.....|  :.:||:.:.|     .:|.:|...|..:|:            |
Zfish    68 VWTALLLTCHQIYMHLRYYSSPKEQRHIVRIL-----FIVPIYAFDSWLSLLFFTNDQYYVYFDT 127

  Fly   102 ILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCC------- 159
            :...|..|:.:.            |.:|.:.|:|.|...:.|..|:.::.:.....||       
Zfish   128 VRDCYEAFVIYN------------FLSLCYEYLGGESAIMAEIRGKPIESSCIYGTCCLWGKTYS 180

  Fly   160 --------------CLCLP-MVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDI--QLYRQ 207
                          |:..| |.|.|.......:|.  ...|...|..|.:.|:|...:  .||..
Zfish   181 IGFLRFCKQATLQFCVVKPLMAIITVILQAFGKYR--DGDFNVASGYLYVTIIYNISVSLSLYAL 243

  Fly   208 VMFFFIP-------------FIVCSIV-LGAW------------------SLQITVRMITKVRGD 240
            .:|:|..             |:|.|:: |..|                  |.:::|...|...| 
Zfish   244 FLFYFSTRDLLSPYRPMLKFFMVKSVIFLSFWQGMLLAILEKCGAIPQISSPEVSVGEGTVAAG- 307

  Fly   241 YQLRKKMFCLQLVVMLCKLQYLVLY--------DQLDGIKMGGEY 277
            ||  ..:.|:::......|::...|        |.|..:...|||
Zfish   308 YQ--NFIICIEMFFAALALRHAFTYTVYMDKRLDSLGPVPTYGEY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 59/305 (19%)
tmem184baXP_005156201.1 Solute_trans_a 60..331 CDD:281602 53/284 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.