DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and slc51a

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001004546.1 Gene:slc51a / 447807 ZFINID:ZDB-GENE-040912-10 Length:326 Species:Danio rerio


Alignment Length:310 Identity:64/310 - (20%)
Similarity:128/310 - (41%) Gaps:45/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AFLSLAIFIASLLTILNISIFATTV----------SRLRRHLDKPLLGPSIMMVGLYPIISVAAL 99
            |...|.||...|.|:|.:...|:.:          .::..|....:    |.:.|:.|::::.:.
Zfish    23 AIKQLDIFGKVLYTVLTLMATASMLVFIEECIYIYKKVPAHKKSTI----IWVTGVAPVMAIMSC 83

  Fly   100 VTILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLP 164
            :.:.||.:...........|.:....|..|:...||.:..:::....:..:::|.||||||.|||
Zfish    84 LGMWVPRATMFTDMTSATYFAIVVFKFLILMIEEVGGDNAFLRRCEKQTFKISTGPCCCCCPCLP 148

  Fly   165 MVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDIQLYRQVMF------------FFIPFIV 217
            .|..|:..|.|.:...:|...    :.||:.|.   .|.|:....|            :...||.
Zfish   149 NVPITRRSLFILKLGSYQFAL----MKLVLTIF---SIVLWTNGSFSLTNVSASGAAIWINSFIG 206

  Fly   218 CSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEY----P 278
            ...::..|.:.|....:.:.....::..|....|||::|.:||..:    ::.:.:.|..    |
Zfish   207 VLTIIALWPVAIMFMHVREALRTLKIVPKYAMYQLVLILSQLQTAI----INILALNGTIACSPP 267

  Fly   279 INHTVYKQTIINILILVEMVLVSMMVQSAYR---TPVQVQIDEVNKEKEV 325
            .:.......:...|::|||.:::::.:..||   .|:. :.|:|.::|.|
Zfish   268 YSSQARGYMMSQQLLIVEMFIITLVTRVLYRRQYEPIP-EPDDVEEKKTV 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 55/284 (19%)
slc51aNP_001004546.1 Solute_trans_a 34..298 CDD:281602 53/278 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 1 1.010 - - D1374406at2759
OrthoFinder 1 1.000 - - FOG0006603
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107589
Panther 1 1.100 - - LDO PTHR23423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.