DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Tmem184b

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006242075.1 Gene:Tmem184b / 362959 RGDID:1306591 Length:414 Species:Rattus norvegicus


Alignment Length:302 Identity:57/302 - (18%)
Similarity:109/302 - (36%) Gaps:85/302 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFIASLLTILNISIFATTVSR--LRRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFICHT 113
            ::.|.|:|...|.:.....||  .:||:        :.::.:.||.:..:.:::|     |..:.
  Rat    54 VWTALLITCHQIYMHLRCYSRPNEQRHI--------VRILFIVPIYAFDSWLSLL-----FFTND 105

  Fly   114 VMHVMFMVGGPV-----------FRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCC-------- 159
            ..:|.|   |.|           |.:|.:.|:|.|...:.|..|:|::.:.....||        
  Rat   106 QYYVYF---GTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSI 167

  Fly   160 -------------CLCLP-MVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDIQLYRQVMF 210
                         |:..| |.:.|.......:|.........|  .|.:.|:|...:.|....:|
  Rat   168 GFLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSG--YLYVTIIYNISVSLALYALF 230

  Fly   211 FFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGI--KM 273
            .|  :.....:|..:|..:                |.|.::.|:.|...|.::|     .|  |.
  Rat   231 LF--YFATRELLSPYSPVL----------------KFFMVKSVIFLSFWQGMLL-----AILEKC 272

  Fly   274 GGEYPINH---TVYKQTII----NILILVEMVLVSMMVQSAY 308
            |....||.   :|.:.|:.    :.:|.:||...::.::.|:
  Rat   273 GAIPKINSARVSVGEGTVAAGYQDFIICIEMFFAALALRHAF 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 57/302 (19%)
Tmem184bXP_006242075.1 Solute_trans_a 46..317 CDD:397604 57/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.