DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Tmem184a

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_038945317.1 Gene:Tmem184a / 304325 RGDID:1306702 Length:460 Species:Rattus norvegicus


Alignment Length:322 Identity:62/322 - (19%)
Similarity:116/322 - (36%) Gaps:100/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFIASLLTILNISIF----ATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALVTILV----PYS 107
            :|:.:.|.:....|:    :.||.|.:|.:        |.::.:.||.:..:.:::|:    ||.
  Rat    99 VFVWTALLLTGHQIYSHLRSYTVPREQRFV--------IRLLFIVPIYAFDSWLSLLLLGGHPYY 155

  Fly   108 WFI-----CHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCC-------- 159
            .:.     |:..    |::..  |.||.|:|:|.|...:.|..|:.::.:.....||        
  Rat   156 VYFDSVRDCYEA----FVIYS--FLTLCFQYLGGESAIMAEIRGKPIRSSCFYGTCCLRGMSYSI 214

  Fly   160 -------------CLCLP-MVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDIQ--LYRQV 208
                         |:..| |.:.|.......:|.........|  .|.:.::|...:.  ||...
  Rat   215 TFLRFCKQATLQFCIVKPVMALITIILQAFDKYHDGDFNIHSG--YLYVTLVYNASVSLALYALF 277

  Fly   209 MFFFI------PF--------IVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKL 259
            :|:|.      ||        |...|.|..|            :|           .|:.:|.:.
  Rat   278 LFYFATRDLLRPFEPVLKFLTIKAIIFLSFW------------QG-----------MLLAILERC 319

  Fly   260 QYLVLYDQLDGIKMG-GEYPINHTVYKQTIINILILVEMVLVSMMVQSAYRTPVQVQIDEVN 320
            ..:.....:||.::| |.....:.       |.||.:||:..|:.::.|:  |.||..::.|
  Rat   320 GVIPEVQAVDGTRVGAGTLAAGYQ-------NFLICIEMLFASLALRYAF--PSQVYSEKKN 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 58/309 (19%)
Tmem184aXP_038945317.1 Solute_trans_a 96..365 CDD:397604 59/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.