DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Tmem184c

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006255484.1 Gene:Tmem184c / 291946 RGDID:727852 Length:545 Species:Rattus norvegicus


Alignment Length:324 Identity:64/324 - (19%)
Similarity:118/324 - (36%) Gaps:100/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NRNNTNS--------------LRTHPT-VEEYYENMTAFLSLAIFIASLLTILNISIFATTVSRL 72
            ||||...              |.|.|. :.|:.:......:...|||.:..:|.|.:....:.:.
  Rat    48 NRNNWRKWIRPLLILLYALAILVTVPVCIWEFQKLKVGIHTKVWFIAGIFLLLTIPVSMCGILQH 112

  Fly    73 RRHLDKP-LLGPSIMMVGLYPIISVAALVTILVPY------SWFICHTVMHVM-FMVGGPVFRTL 129
            ..|..:| |..|.|.::.:.||.|:.:.|.:..|.      :|..|:....:. ||:....:.|:
  Rat   113 LVHYTQPELQKPIIRILWMVPIYSLDSWVALKYPKIAIYVDTWRECYEAYVIYNFMIFLTNYLTI 177

  Fly   130 LFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLV- 193
            .|      .|.:.....:..|.:.||.|||                        |.|....||: 
  Rat   178 RF------PNLMLHLEAKDQQNHLPPLCCC------------------------PPWAMGEMLLF 212

  Fly   194 ---MNILYYRDIQLYRQVMFFFIPFIVCSIVLG-----------AWSLQITVRMITKVRGDYQLR 244
               :.:|.|..::....|     ..:||.| ||           ||:..:.:..::::..     
  Rat   213 RCKLGVLQYTVVRPITTV-----TSLVCEI-LGVYDEGNFSFSNAWTYLVILNNLSQLFA----- 266

  Fly   245 KKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILV---EMVLVSMMVQ 305
              |:||.|.       |.||.::|..|:..|::         ..:.:::.|   :.||::::|:
  Rat   267 --MYCLLLF-------YKVLKEELSPIQPVGKF---------LCVKLVVFVSFWQAVLIALLVK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 56/282 (20%)
Tmem184cXP_006255484.1 Solute_trans_a 90..358 CDD:281602 56/282 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.