DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and TMEM184B

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_016884243.1 Gene:TMEM184B / 25829 HGNCID:1310 Length:452 Species:Homo sapiens


Alignment Length:261 Identity:49/261 - (18%)
Similarity:91/261 - (34%) Gaps:72/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IISVAALVTILVPYSW----FICHTVMHVMFMVGGPV-----------FRTLLFRYVGSEQNYVK 142
            |:.:..:|.|....||    |..:...:|.|   |.|           |.:|.:.|:|.|.:.:.
Human   114 IVRILFIVPIYAFDSWLSLLFFTNDQYYVYF---GTVRDCYEALVIYNFLSLCYEYLGGESSIMS 175

  Fly   143 ETAGEAVQLNTPPCCCC---------------------CLCLP-MVIPTKAKLCISRYMVWQMPF 185
            |..|:.::.:.....||                     |:..| |.:.|.......:|.......
Human   176 EIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDV 240

  Fly   186 WQGSIMLVMNILYYRDIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCL 250
            ..|  .|.:.|:|...:.|....:|.|  :.....:|..:|..:                |.|.:
Human   241 TSG--YLYVTIIYNISVSLALYALFLF--YFATRELLSPYSPVL----------------KFFMV 285

  Fly   251 QLVVMLCKLQYLVLYDQLDGIKMGGEYPINH----TVYKQTII----NILILVEMVLVSMMVQSA 307
            :.|:.|...|.::|..    ::..|..|..|    :|.:.|:.    :.:|.|||...::.::.|
Human   286 KSVIFLSFWQGMLLAI----LEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHA 346

  Fly   308 Y 308
            :
Human   347 F 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 49/261 (19%)
TMEM184BXP_016884243.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.