DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and SPAC30D11.06c

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_593211.1 Gene:SPAC30D11.06c / 2543068 PomBaseID:SPAC30D11.06c Length:426 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:57/312 - (18%)
Similarity:112/312 - (35%) Gaps:112/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FIASLLTILNISIFATTVSRLRRHLDKPLLGPSI----MMVGLYPIISVAALV-----TILVPYS 107
            |:|..|.:..|||    ::.|:.: .||:|..|:    ||:.:|..:|..::.     :|..|:.
pombe    12 FVAIALVLSCISI----ITHLKNY-KKPVLQRSVVRILMMIVIYSSVSFLSVYNEKIGSIFEPFR 71

  Fly   108 WFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAK 172
            .......::..|        .||..|:|.|:..|....|.               ||        
pombe    72 EIYEAFALYCFF--------CLLIDYLGGERAAVISLHGH---------------LP-------- 105

  Fly   173 LCISRYMVWQMPFWQGSIMLVMNILYYRDIQLYRQVMFF--FIPFIVCSIVLGAWSLQITVRMIT 235
                |..:|.:.:.|..|.|...   |..:.:.|.::.:  ..||:|.:::|            |
pombe   106 ----RPRLWPLNYLQDDIDLSDP---YTFLSIKRGILQYTWLKPFLVIAVLL------------T 151

  Fly   236 KVRGDYQLRKK------------MFCLQLVVMLCKLQ--YLVLYDQLDGIKMGGEYP-------- 278
            ||.|.|....:            ::.:.:.:.|..|.  ::.|:::|...:   .:|        
pombe   152 KVTGVYDREDQPVYASADLWIGLVYNISITLSLYSLTTFWVCLHEELAPFR---PFPKFLSVKAI 213

  Fly   279 INHTVYKQTII---------------------NILILVEMVLVSMMVQSAYR 309
            |..:.::||::                     |:|:.:||...::....|:|
pombe   214 IFASYWQQTVLSITNWLGLLNGTGWIYSLLNQNVLMCLEMPFFALSHWYAFR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 56/310 (18%)
SPAC30D11.06cNP_593211.1 Solute_trans_a 7..268 CDD:281602 57/312 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.