DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Tmem184c

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001351374.1 Gene:Tmem184c / 234463 MGIID:2384562 Length:662 Species:Mus musculus


Alignment Length:335 Identity:64/335 - (19%)
Similarity:123/335 - (36%) Gaps:102/335 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENISQVLDQNRNNTNSLR-THPTVEEYYENMTAFLSLAI-----------------FIASLLTIL 60
            ||:.|.:....|.:|..| ..|.:..:|.. |..:::.|                 |||.:..:|
Mouse    35 ENLLQNMPCACNRSNWRRWIRPLLVLFYAT-TILVAVPICIWKFQKMKVGMHTKSWFIAGIFLLL 98

  Fly    61 NISIFATTVSRLRRHLDKP-LLGPSIMMVGLYPIISVAALVTILVPY------SWFICHTVMHVM 118
            .|.:....:.:...|..:| |..|.|.::.:.||.||.:.|.::.|.      :|..|:....:.
Mouse    99 TIPVSLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWVALVYPKIAIYVDTWRECYEAYVIY 163

  Fly   119 -FMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQ 182
             ||:....:.|:.|      .|.:.....:..|.:..|.|||                       
Mouse   164 NFMIFLTNYLTIRF------PNLILHLEAKDQQNHILPLCCC----------------------- 199

  Fly   183 MPFWQGSIMLV----MNILYYRDIQLYRQVMFFFIPFIVCSIV----------LGAWSLQITVRM 233
             |.|....||:    :.:|.|..::....|     ..:||.|:          ..||:..:.:..
Mouse   200 -PPWAMGEMLLFRCKLGVLQYTVVRPITTV-----TALVCEILDVYDEGNFGFSNAWTYLVILNN 258

  Fly   234 ITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILV--- 295
            ::::..       |:||.|.       |.||.::|..|:..|::         ..:.:::.|   
Mouse   259 LSQLFA-------MYCLLLF-------YKVLKEELSPIQPVGKF---------LCVKLVVFVSFW 300

  Fly   296 EMVLVSMMVQ 305
            :.||::::|:
Mouse   301 QAVLIALLVK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 55/298 (18%)
Tmem184cNP_001351374.1 Solute_trans_a 90..356 CDD:308940 54/279 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.