DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Tmem184b

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001365927.1 Gene:Tmem184b / 223693 MGIID:2445179 Length:443 Species:Mus musculus


Alignment Length:324 Identity:63/324 - (19%)
Similarity:119/324 - (36%) Gaps:90/324 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PTVEEY--YENMTAFLSLA---IFIASLLTILNISIFATTVSR--LRRHLDKPLLGPSIMMVGLY 91
            ||..|:  :...||..:::   ::.|.|:|...|.:.....||  .:||:        :.::.:.
Mouse    61 PTAMEHPVFLMTTAAQAISGFFVWTALLITCHQIYMHLRCYSRPNEQRHI--------VRILFIV 117

  Fly    92 PIISVAALVTILVPYSWFICHTVMHVMFMVGGPV-----------FRTLLFRYVGSEQNYVKETA 145
            ||.:..:.:::|     |..:...:|.|   |.|           |.:|.:.|:|.|...:.|..
Mouse   118 PIYAFDSWLSLL-----FFTNDQYYVYF---GTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIR 174

  Fly   146 GEAVQLNTPPCCCC---------------------CLCLP-MVIPTKAKLCISRYMVWQMPFWQG 188
            |:|::.:.....||                     |:..| |.:.|.......:|.........|
Mouse   175 GKAIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSG 239

  Fly   189 SIMLVMNILYYRDIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLV 253
              .|.:.|:|...:.|....:|.|  :.....:|..:|..:                |.|.::.|
Mouse   240 --YLYVTIIYNISVSLALYALFLF--YFATRELLSPYSPVL----------------KFFMVKSV 284

  Fly   254 VMLCKLQYLVLYDQLDGI--KMGGEYPINH---TVYKQTII----NILILVEMVLVSMMVQSAY 308
            :.|...|.::|     .|  |.|....||.   :|.:.|:.    :.:|.|||...::.::.|:
Mouse   285 IFLSFWQGMLL-----AILEKCGAIPKINSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 58/306 (19%)
Tmem184bNP_001365927.1 Solute_trans_a 75..346 CDD:397604 58/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.