DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and TMEM184A

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001091089.1 Gene:TMEM184A / 202915 HGNCID:28797 Length:413 Species:Homo sapiens


Alignment Length:315 Identity:61/315 - (19%)
Similarity:119/315 - (37%) Gaps:90/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFIASLLTI----LNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFI- 110
            ||:.:.|.:    :.:.:.:.||.:.:|::.:.||     :|.:|...|..:|: :|..:.::: 
Human    61 IFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLL-----IVPIYAFDSWLSLL-LLGDHQYYVY 119

  Fly   111 ------CHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCC---------- 159
                  |:..    |::..  |.:|.|:|:|.|...:.|..|:.::.:.....||          
Human   120 FDSVRDCYEA----FVIYS--FLSLCFQYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGF 178

  Fly   160 -----------CLCLP-MVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYRDIQ--LYRQVMF 210
                       ||..| |.:.|.......:|.........|  .|.:.::|...:.  ||...:|
Human   179 LRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSG--YLYVTLIYNASVSLALYALFLF 241

  Fly   211 FFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVL----------- 264
            :|                 |.|.:.:   .:|...|...::.|:.|...|.|:|           
Human   242 YF-----------------TTRELLR---PFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPE 286

  Fly   265 YDQLDGIKMG-GEYPINHTVYKQTIINILILVEMVLVSMMVQSAYRTPVQVQIDE 318
            .:...|.|:| |.....:.       |.:|.|||:..|:.::.|:  |.||..::
Human   287 VETSGGNKLGAGTLAAGYQ-------NFIICVEMLFASVALRYAF--PCQVYAEK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 58/304 (19%)
TMEM184ANP_001091089.1 Solute_trans_a 55..325 CDD:281602 58/306 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.