DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and SLC51A

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_689885.4 Gene:SLC51A / 200931 HGNCID:29955 Length:340 Species:Homo sapiens


Alignment Length:335 Identity:63/335 - (18%)
Similarity:135/335 - (40%) Gaps:43/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNASENYFTMDP--TENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLAIFIASLLTIL--- 60
            |........:||  |.::.:||..|....::..:.|....  :.:.|...:.:.:.|:||:|   
Human     1 MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAA--QLLRALGPVELALTSILTLLALG 63

  Fly    61 NISIFATTVSRLRRHLDKPLLGPSIMMVGLYP-IISVAALVTILVPYSWFICHTVMHVMFMVGGP 124
            :|:||......|.::...|:...:::.....| ::||.....:.:|.|..:....:...:.|...
Human    64 SIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTITSFYAVCFY 128

  Fly   125 VFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGS 189
            :...::....|.::..::......:.::|.||||||.|.|.::.|:.||    .::...||....
Human   129 LLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKL----QLLMLGPFQYAF 189

  Fly   190 IMLVMNILYYRDIQLYRQVMFFFIP--------------------FIVCSIVLGAWSLQITVRMI 234
            :.:.:.:           |..|.:|                    |:..|.:|..|:|.|..|..
Human   190 LKITLTL-----------VGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIISRQA 243

  Fly   235 TKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILVEMVL 299
            ....|:..:..|....|::::|..||..:.....:|.::....|.:.....|.:...|:::|..|
Human   244 RLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCHLLILETFL 308

  Fly   300 VSMMVQSAYR 309
            ::::.:..||
Human   309 MTVLTRMYYR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 52/282 (18%)
SLC51ANP_689885.4 Solute_trans_a 53..321 CDD:281602 54/281 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 1 1.010 - - D1374406at2759
OrthoFinder 1 1.000 - - FOG0006603
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107589
Panther 1 1.100 - - O PTHR23423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.