DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and osta-1

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_493630.2 Gene:osta-1 / 182062 WormBaseID:WBGene00015287 Length:384 Species:Caenorhabditis elegans


Alignment Length:227 Identity:50/227 - (22%)
Similarity:89/227 - (39%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLAIFIASLLTILNISIFATTVSR------- 71
            |.:..::..||:....  ..|:..|:..||      ::...|.|||..:.:..|.:|.       
 Worm     2 EIVKTIIPHNRSYIEP--PIPSATEWLANM------SVMHVSCLTIACVFVAITFLSSFFHLFFV 58

  Fly    72 LRRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGS 136
            |:...::.:......::.::||.:.|:||.:.:|.:....:.|..|.||....:..||||...|.
 Worm    59 LKYVSNERIRNDMYALIFMFPITTFASLVGMFIPRAAIFLYAVSLVYFMFTLFIMVTLLFNIFGG 123

  Fly   137 EQNYVKETAGEAVQLN-TPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYR 200
            .|..........:::| |.|..|....||.|..|...|....::|:|.|..:..:.||..::...
 Worm   124 RQEMSAYLLQRNIRVNFTVPPLCFFKFLPTVESTDQNLRRIEWLVFQTPIIRTLLELVSVVVSME 188

  Fly   201 DIQLYRQVMFFF----------IPFIVCSIVL 222
            .......|.|.|          |.|..|.:::
 Worm   189 QEGRRESVWFVFSQLMALLSMCIAFYGCYVMV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 43/191 (23%)
osta-1NP_493630.2 Solute_trans_a 36..296 CDD:281602 42/185 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107589
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.