DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and osta-3

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_497071.1 Gene:osta-3 / 175140 WormBaseID:WBGene00012182 Length:348 Species:Caenorhabditis elegans


Alignment Length:311 Identity:54/311 - (17%)
Similarity:124/311 - (39%) Gaps:43/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLAIFIASLLT--ILNISIF-------ATTVSRL 72
            |.:|.|:.:|.:.....|:..|:..::..|.::.:.|||..|  :|.:|:.       ..::.:.
 Worm    17 SVMLPQDTSNCSDRHDTPSAPEFLSHLQPFQTVLLSIASFSTTIVLCLSLIHWFYVYKYVSIEKR 81

  Fly    73 RRHLDKPLLGPSIMMVGLYPIISVAALVTILVPYSWFI--CHTVMHVMFMVGGPVFRTLLFRYVG 135
            |..|        ..::.::|:....:.:.:.||.:..|  |..|::.:..:.  |..:|.....|
 Worm    82 RNKL--------YWLIAVFPVACSCSFIAMCVPRTAVILTCIGVLYYLMCLF--VIVSLARHLFG 136

  Fly   136 SEQNY--VKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILY 198
            ..:::  ..:.....:...:||.||....||....|:..:....:.|.|.|       :|.:|:.
 Worm   137 GRESFSTCLQYDDRPIDFRSPPFCCIIPKLPTARSTEKNIRRLEWCVLQAP-------IVRSIII 194

  Fly   199 YRDIQLYRQVMFFFIPFI-------VCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVML 256
            :.|:....::.....|:|       :||::|..:.:....|:.:.....|........:.:.::.
 Worm   195 FLDVVAVAEMREDATPYIRYSDMASLCSLLLAIFGVHTLARVTSNKLSAYCFMSMFRLVDISLLF 259

  Fly   257 CKLQYLVLYD----QLDGIKMGGEYPINHTVYKQTIINILILVEMVLVSMM 303
            ...|..:::.    :.:.|..|.........|  .:.|.:|..||:|:|::
 Worm   260 FSAQQPMIFQNVLLRFNLISCGPLLNAQENAY--FVCNFIITCEMLLLSVL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 47/278 (17%)
osta-3NP_497071.1 Solute_trans_a 50..311 CDD:281602 47/278 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107589
Panther 1 1.100 - - O PTHR23423
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.