DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and Slc51a

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_666044.1 Gene:Slc51a / 106407 MGIID:2146634 Length:340 Species:Mus musculus


Alignment Length:350 Identity:74/350 - (21%)
Similarity:140/350 - (40%) Gaps:73/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNASENYFTMDP--TENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLAI-FIASLLTILNI 62
            |.....:..:||  |..:.::|:.|.:.:.:..:||............:.:|: .|.:.||..::
Mouse     1 MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFLTTGSV 65

  Fly    63 SIFATTVSRLRRHLDKPL---------LGPSIMMV----GLYPIISVAALVTILVPYSWFICHTV 114
            :||......|.::...|:         ..|:::.|    ||: |.....||.:.:...:.:|..:
Mouse    66 AIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLW-IPRALTLVEMAITSFYAVCFYL 129

  Fly   115 MHVMFMVGG-----PVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLC 174
            : :|.||.|     .|.|||            |:|   .::::|.||||||.|.|.:|.|:.|| 
Mouse   130 L-MMVMVEGFGGKKAVLRTL------------KDT---PMRVHTGPCCCCCPCCPPLILTRKKL- 177

  Fly   175 ISRYMVWQMPFWQGSIMLVMNILYYRDIQLYRQVMFFFIP--------------------FIVCS 219
               .::...||......:.::|           |..|.||                    .:..|
Mouse   178 ---QLLLLGPFQYAFFKITLSI-----------VGLFLIPDGIYDPGEISEKSAALWINNLLAVS 228

  Fly   220 IVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVY 284
            .:|..|||.|..|......|:..:..|....|::|:|..||..:.....:..::....|.:..:.
Mouse   229 TLLALWSLAILFRQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIR 293

  Fly   285 KQTIINILILVEMVLVSMMVQSAYR 309
            .|.:...::::|..|::::.:..||
Mouse   294 SQVMNCHMLILETFLMTVLTRMYYR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 64/297 (22%)
Slc51aNP_666044.1 Solute_trans_a 53..321 CDD:281602 64/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006603
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107589
Panther 1 1.100 - - O PTHR23423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.