DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and slc51a-like.1

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_031751517.1 Gene:slc51a-like.1 / 100135183 XenbaseID:XB-GENE-5838770 Length:638 Species:Xenopus tropicalis


Alignment Length:310 Identity:65/310 - (20%)
Similarity:127/310 - (40%) Gaps:28/310 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDQNRNNTN-------SLRTHPTVEEYYENMTAFLSLAIFIASLLTILNISIFATTVSRLRRHLD 77
            :|..:|.|.       ..|..|...|..:|:.....|...:.:.:|::::.:|......:.|.| 
 Frog     1 MDSEQNATEPPYDPICRTRQAPYAYEILQNLDTTGILLFAMLTFMTLISLLVFLEEAYYMYRKL- 64

  Fly    78 KPLLGPSIMMVGLYPIISVAALVT------ILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGS 136
                 |||....:..|.|.|.::.      :.:|.|.........|...:....|:.:|....|.
 Frog    65 -----PSIKSSLIIWINSGAMMIATTSCFGMWIPRSTMFTDFTASVFLAILVHKFQLMLVNECGG 124

  Fly   137 EQNYVKETAGEAVQLNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYR- 200
            .:.::::.....:|::|.|.||||||||.....:..|.|.:...:|..|.:..:|.:..:|:.. 
 Frog   125 RREFIRKFRDRKLQISTGPFCCCCLCLPHTAINRKTLFILKLGTFQFAFLRPVLMFLAVVLWTNG 189

  Fly   201 -----DIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQ 260
                 :..|....|:..:...:.:|. ..|::.:...::.....|..:..|....|..|:|.:||
 Frog   190 TYMIGNSSLDSATMWINVAIAIMTIT-ALWAVGVMFNLVKNTLNDKNIVPKFAVYQFTVILSQLQ 253

  Fly   261 YLVLYDQLDGIK-MGGEYPINHTVYKQTIINILILVEMVLVSMMVQSAYR 309
            ..|: :.|..|. :|.|.|:........:...|:::||.||:::.:..||
 Frog   254 TAVI-NVLGTIGIIGCEPPLPGPSRASYMNQQLLIMEMFLVTVICRVLYR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 55/271 (20%)
slc51a-like.1XP_031751517.1 Solute_trans_a 38..304 CDD:397604 57/273 (21%)
Solute_trans_a 337..603 CDD:397604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45391
OrthoDB 1 1.010 - - D1374406at2759
OrthoFinder 1 1.000 - - FOG0006603
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.