DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6836 and tmem184bb.2

DIOPT Version :9

Sequence 1:NP_649079.2 Gene:CG6836 / 40070 FlyBaseID:FBgn0036834 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_009305846.1 Gene:tmem184bb.2 / 100001019 ZFINID:ZDB-GENE-111011-1 Length:409 Species:Danio rerio


Alignment Length:360 Identity:63/360 - (17%)
Similarity:126/360 - (35%) Gaps:98/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MDPTENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFL---------SLAIFIASLLTILNISI- 64
            |.|...:..|..::.|.:..:.|..|        ..||         .:..:.|.|||...|.: 
Zfish    20 MAPGPGVVTVAPESHNRSGPVLTPET--------PIFLMTPAAQGISGIFTWTALLLTCQQIYMH 76

  Fly    65 --FATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALV------------TILVPYSWFICHTVM 115
              :..|.:. :||:.:.|     .:|.:|...|..:|:            |:...|..|:.:.  
Zfish    77 LRYYNTPNE-QRHIVRIL-----FIVPIYAFDSWLSLLFFTNEEYYVYFDTVRDCYEAFVIYN-- 133

  Fly   116 HVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQLNTPPCCCCC-----------LCLPMVIPT 169
                      |.:|.:.|:|.|...:.|..|:.:|.:.....||.           .|....:  
Zfish   134 ----------FLSLCYEYLGGESAIMAEIRGKPIQSSFVYGTCCLWGRTYSIGFLRFCKQATL-- 186

  Fly   170 KAKLCISRYMVWQMPFWQGSIMLVMNILY-----YRDIQLYRQVMFFFIPFIV-CSIVLGAWSLQ 228
              :.|:.:           .:|.::.::.     |||........:.::..|. .|:.|..::|.
Zfish   187 --QFCVVK-----------PLMAIITVILQAFGKYRDGDFNAAGGYLYVMIIYNVSVSLSLFALF 238

  Fly   229 ITVRMITKVRGDYQLRKKMFCLQLVVMLCKLQYLVLYDQLDGI--KMGGEYPINH---TVYKQTI 288
            :......::...|....|...::.|:.|...|.::|     .|  |.|....|:.   :|.:.|:
Zfish   239 LFYSATAELLEPYSPMLKFLMVKSVIFLSFWQGMLL-----AILEKCGAFARISSPDVSVGEGTV 298

  Fly   289 I----NILILVEMVLVSMMVQSA--YRTPVQVQID 317
            .    |.:|..||...::.::.|  |:..:..::|
Zfish   299 AAGYQNFIICCEMFFAALALRHAFTYKVYMDKRLD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6836NP_649079.2 Solute_trans_a 50..309 CDD:281602 53/301 (18%)
tmem184bb.2XP_009305846.1 Solute_trans_a 54..325 CDD:281602 53/308 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.