DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and NUC1

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:74/340 - (21%)
Similarity:129/340 - (37%) Gaps:71/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CTSSLASPLSGKSVTAKCVGGTTFKIDDKEHDLSAIKCTSWPVFVGKKSGSSCNG------GTTL 151
            |:..|.|.|.|.....    |.|:.:.:| |..:.|..|.:|  ..:|..|:...      .:..
Yeast     2 CSRILLSGLVGLGAGT----GLTYLLLNK-HSPTQIIETPYP--PTQKPNSNIQSHSFNVDPSGF 59

  Fly   152 IKVGF--ELSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDK 214
            .|.||  .:...:...::..|:|...:...:|...:.|.:                 .|.:|.|:
Yeast    60 FKYGFPGPIHDLQNREEFISCYNRQTQNPYWVLEHITPES-----------------LAARNADR 107

  Fly   215 LYTQAVQKETIDKELDMDSSRFFDSAKNIFLA---RGHMGAKADFVFAPEQRA---TFLFINAAP 273
                   |.:..||.::...:|....::.|.:   |||....||..|:  |:|   ||...|..|
Yeast   108 -------KNSFFKEDEVIPEKFRGKLRDYFRSGYDRGHQAPAADAKFS--QQAMDDTFYLSNMCP 163

  Fly   274 Q-WQTFNAGNWARVEDGVRAWVAKENKHVECWTGVWGVTTLPNKNGEQRQLYLSHDNNGN-GLIP 336
            | .:.||...||.:|...|. :.|:.|.|..   |.|...||.|:....:..::::..|| ..|.
Yeast   164 QVGEGFNRDYWAHLEYFCRG-LTKKYKSVRI---VTGPLYLPKKDPIDNKFRVNYEVIGNPPSIA 224

  Fly   337 VPKLYFRVVI------EPSTKK-GIVLIGVNNPHLSLEEIKRDYILCTDVSDRINWISWKKTDIT 394
            ||..:|::::      .|:.:. .:....:.|..:|.|....|:.:..|..:|           :
Yeast   225 VPTHFFKLIVAEAPTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALER-----------S 278

  Fly   395 AGYSYACEVPEFRKK 409
            .|.....:||..:||
Yeast   279 TGLELLQKVPPSKKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 57/261 (22%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 72/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.