DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and endog

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001017202.1 Gene:endog / 549956 XenbaseID:XB-GENE-998565 Length:293 Species:Xenopus tropicalis


Alignment Length:141 Identity:37/141 - (26%)
Similarity:70/141 - (49%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DKLYTQAVQKETIDKELDMDSSRFFDSAKNIF----LARGHMGAKADFVFAPEQRA---TFLFIN 270
            ::|:..| :::..|.:.|:...::..:|.:.|    ..|||:.|.|:..::  |:|   ||:..|
 Frog    99 ERLHGSA-ERQGCDFQEDVSVHQYHRAANSDFKGSGFDRGHLAAAANHKWS--QKAMDETFILSN 160

  Fly   271 AAPQWQTFNAGNWARVEDGVRAWVAKENKHVECWTGVWGVTTLPNKNGEQRQLYLSHDNNGNGLI 335
            ..||....|...|..:|...|: :.|:||:|...|   |...||.:..: ..:|:.:...|:..:
 Frog   161 IYPQNPHLNQKAWNNLERYCRS-LTKKNKNVYVCT---GPLFLPRREPD-GNMYVKYQVIGSNNV 220

  Fly   336 PVPKLYFRVVI 346
            .||..:|:||:
 Frog   221 AVPTHFFKVVV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 37/141 (26%)
endogNP_001017202.1 NUC 75..282 CDD:214683 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.