DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and EndoG

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:293 Identity:61/293 - (20%)
Similarity:111/293 - (37%) Gaps:62/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IKCTSWPVFVGKKSGSSCNGGTTLIKVGFE-LSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNY 191
            :..|:.|..:|:           ::|.||. |...|..:.|.:.::....|..:|:..|      
  Fly    64 VSLTATPSRIGQ-----------IMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHL------ 111

  Fly   192 YATGVDRITFGAGGYFAGKNVDKLYTQAVQKETIDKELDMDSSRFFDSAKNIF----LARGHMGA 252
                            ..::|.|  ..||.:...|.:.|.....||.|....:    ..||||.|
  Fly   112 ----------------TAESVAK--NDAVDRSKCDFKQDESIHPFFRSQNTDYRRSGYDRGHMAA 158

  Fly   253 KADF-VFAPEQRATFLFINAAPQ-WQTFNAGNWARVEDGVRAWVAKENKHVECWTGVWGVTTLPN 315
            ..:. :.......||...|.||| .|.||...|..:|..||. :.|...:|...|   |...||:
  Fly   159 AGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRR-LTKTYSNVYVCT---GPLYLPH 219

  Fly   316 KNGEQRQLYLSHDNNGNGLIPVPKLYFRVVIEPSTKKGIVLIGVNNPH-LSLEE-IKRDYILCTD 378
            |..:.:. |:.::..|...:.||..:::|:           :|.:..| |.:|. :..:.::..|
  Fly   220 KEDDGKS-YVKYEVIGANTVAVPTHFYKVI-----------VGESADHKLHMESYVMPNQVISND 272

  Fly   379 VSDRINWISWKKTDITAGYSYACEVPEFRKKVT 411
            ....:..:..:..:.:||..:..::.  ||::|
  Fly   273 TPISVFQVPPESVERSAGLLFFDQIN--RKQLT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 53/256 (21%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 61/293 (21%)
NUC 77..309 CDD:238043 58/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.