DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and Endog

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:201 Identity:46/201 - (22%)
Similarity:72/201 - (35%) Gaps:62/201 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDKLYTQAVQKETIDKELDMDSSR 235
            |:||:.|  :.|||        ||..|         :.|...|                      
  Rat   112 FHEDDSV--HAYHR--------ATNAD---------YRGSGFD---------------------- 135

  Fly   236 FFDSAKNIFLARGHMGAKADFVFAPEQRA---TFLFINAAPQWQTFNAGNWARVEDGVRAWVAKE 297
                       |||:.|.|:..::  |||   ||...|.|||....|...|..:|...|: :.:.
  Rat   136 -----------RGHLAAAANHRWS--QRAMDDTFYLSNVAPQVPHLNQHAWNNLEKYSRS-LTRT 186

  Fly   298 NKHVECWTGVWGVTTLPNKNGEQRQLYLSHDNNGNGLIPVPKLYFRVVIEPSTKKGIVLIGVNNP 362
            .::|...|   |...||....:.:. |:.:...|...:.||..:|:|:|..:....|.|.....|
  Rat   187 YQNVYVCT---GPLFLPRTEADGKS-YVKYQVIGKNHVAVPTHFFKVLILEAASGQIELRSYVMP 247

  Fly   363 HLSLEE 368
            :..::|
  Rat   248 NAPVDE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 46/201 (23%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 46/201 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.