powered by:
Protein Alignment CG3819 and Tengl1
DIOPT Version :9
| Sequence 1: | NP_001262027.1 |
Gene: | CG3819 / 40069 |
FlyBaseID: | FBgn0036833 |
Length: | 423 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_722780.1 |
Gene: | Tengl1 / 318883 |
FlyBaseID: | FBgn0051682 |
Length: | 319 |
Species: | Drosophila melanogaster |
| Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
| Similarity: | 17/40 - (42%) |
Gaps: | 4/40 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 KIRSSELKDPQPLLIKSDTSEIVGF----SDTGYVDVDKD 86
|||..|.::|....|:.....::|. .|....|||.|
Fly 33 KIRRLEQRNPHAYFIRRKLYALLGIFAVRPDNSEFDVDTD 72
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG3819 | NP_001262027.1 |
NUC |
164..415 |
CDD:238043 |
|
| Tengl1 | NP_722780.1 |
Endonuclease_NS |
98..275 |
CDD:214889 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR13966 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.
