DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and Exog

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:226 Identity:50/226 - (22%)
Similarity:82/226 - (36%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LIKVGFELSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDKL 215
            |.:.||.|:|:              |..||..|.|                   .|...|.|.:.
Mouse    62 LEQFGFPLAGT--------------ETRRYTNHAL-------------------SYDQAKRVPRW 93

  Fly   216 YTQAVQKETIDKELDMDSSRF---------FDSAKNIFL----ARGHMGAKADFVFAPEQRA-TF 266
            ..:.:.|:.|..:.|....:|         |.:....::    :||||....:..|:.|..| ||
Mouse    94 VLEHISKDKIIGDADRKHCKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETF 158

  Fly   267 LFINAAPQWQTFNAGNWARVEDGVRAWVAKENKHVECWTGVW---GVTTLPNKNGEQRQLYLSHD 328
            ...|..||....|:|.|.|:|...|       :..|.:..||   |..|||:...:..:. :|:.
Mouse   159 YLSNIVPQNFDNNSGYWNRIEMYCR-------ELTERFEDVWIVSGPLTLPHTRNDGTKT-VSYQ 215

  Fly   329 NNGNGLIPVPKLYFRVVI---EPSTKKGIVL 356
            ..|...:.||...::|::   .|.:.:.:.|
Mouse   216 VIGEDNVAVPSHLYKVILARRSPESTEPLAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 45/213 (21%)
ExogNP_766044.1 NUC 77..287 CDD:214683 43/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.