DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and Exog

DIOPT Version :10

Sequence 1:NP_649078.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:226 Identity:50/226 - (22%)
Similarity:82/226 - (36%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LIKVGFELSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDKL 215
            |.:.||.|:|:              |..||..|.|                   .|...|.|.:.
Mouse    62 LEQFGFPLAGT--------------ETRRYTNHAL-------------------SYDQAKRVPRW 93

  Fly   216 YTQAVQKETIDKELDMDSSRF---------FDSAKNIFL----ARGHMGAKADFVFAPEQRA-TF 266
            ..:.:.|:.|..:.|....:|         |.:....::    :||||....:..|:.|..| ||
Mouse    94 VLEHISKDKIIGDADRKHCKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETF 158

  Fly   267 LFINAAPQWQTFNAGNWARVEDGVRAWVAKENKHVECWTGVW---GVTTLPNKNGEQRQLYLSHD 328
            ...|..||....|:|.|.|:|...|       :..|.:..||   |..|||:...:..:. :|:.
Mouse   159 YLSNIVPQNFDNNSGYWNRIEMYCR-------ELTERFEDVWIVSGPLTLPHTRNDGTKT-VSYQ 215

  Fly   329 NNGNGLIPVPKLYFRVVI---EPSTKKGIVL 356
            ..|...:.||...::|::   .|.:.:.:.|
Mouse   216 VIGEDNVAVPSHLYKVILARRSPESTEPLAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_649078.1 NUC 164..415 CDD:238043 45/213 (21%)
ExogNP_766044.1 NUC 77..287 CDD:214683 43/197 (22%)
Exog_C 302..350 CDD:465620
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.