DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and ENDOG

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG / 2021 HGNCID:3346 Length:338 Species:Homo sapiens


Alignment Length:161 Identity:38/161 - (23%)
Similarity:53/161 - (32%) Gaps:61/161 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 EVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYFAGKNVDKLYTQAVQKETIDKELDMD 232
            |..|.||:.|  :.|||        ||..|         :.|...|                   
Human   201 ECDFREDDSV--HAYHR--------ATNAD---------YRGSGFD------------------- 227

  Fly   233 SSRFFDSAKNIFLARGHMGAKADFVFAPEQRA---TFLFINAAPQWQTFNAGNWARVEDGVRAWV 294
                          |||:.|.|:..::  |:|   ||...|.|||....|...|..:|...|: :
Human   228 --------------RGHLAAAANHRWS--QKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRS-L 275

  Fly   295 AKENKHVECWTGVWGVTTLPNKNGEQRQLYL 325
            .:..::|...|   |...||....|.|..:|
Human   276 TRSYQNVYVCT---GPLFLPRLGMESRPHHL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 38/161 (24%)
ENDOGXP_011516649.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.