DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and cps-6

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_491371.1 Gene:cps-6 / 172045 WormBaseID:WBGene00000787 Length:308 Species:Caenorhabditis elegans


Alignment Length:249 Identity:52/249 - (20%)
Similarity:93/249 - (37%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LIKVGFE-LSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDR--------ITFGAGGY 206
            ::|.|:. .:..|....:.:.::.......:|...|.|....:|.||||        |||     
 Worm    69 IMKHGYPGFTNVRTYEDFVLSYDYKTRTAHWVCEHLTPERLKHAEGVDRKLCEFKPDITF----- 128

  Fly   207 FAGKNVDKLYTQAVQKETIDKELDMDSSRFFDSAKNIFLARGHMGAKADF---VFAPEQRATFLF 268
                          .::.:.:..|...|.|         .|||:.|..:.   ..|.:|  ||..
 Worm   129 --------------PQKFLSQNTDYKCSGF---------DRGHLAAAGNHRKSQLAVDQ--TFYL 168

  Fly   269 INAAPQ-WQTFNAGNWARVEDGVRAWVAKE--NKHVECWTGVWGVTTLPNKNGEQRQLYLSHDNN 330
            .|.:|| .:.||...|..:|...|. |||:  |.::     :.|...||...|:.:: |:.:...
 Worm   169 SNMSPQVGRGFNRDKWNDLEMHCRR-VAKKMINSYI-----ITGPLYLPKLEGDGKK-YIKYQVI 226

  Fly   331 GNGLIPVPKLYFRVVIEPSTKKGIVL-------------IGVNNPHLSLEEIKR 371
            |:..:.||..:|:|.:...|.....|             :.::..|:.|:.::|
 Worm   227 GDNNVAVPTHFFKVALFEVTPGKFELESYILPNAVIEDTVEISKFHVPLDAVER 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 49/235 (21%)
cps-6NP_491371.1 NUC1 10..308 CDD:224777 52/249 (21%)
NUC 83..293 CDD:214683 49/235 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.