DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3819 and endog

DIOPT Version :9

Sequence 1:NP_001262027.1 Gene:CG3819 / 40069 FlyBaseID:FBgn0036833 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001019385.1 Gene:endog / 100002293 ZFINID:ZDB-GENE-050522-402 Length:306 Species:Danio rerio


Alignment Length:274 Identity:61/274 - (22%)
Similarity:110/274 - (40%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 SCNGGTTLIKVGF-ELSGSRFATQYEVCFNEDEEVTRYVYHRLEPGNNYYATGVDRITFGAGGYF 207
            |.|..|..:|.|| .||..:....|...::.......:|..:|   |....||            
Zfish    68 SVNRSTAAMKYGFPSLSNIKSRESYVTSYDPRNRTAAWVIEQL---NAETVTG------------ 117

  Fly   208 AGKNVDKLYTQAVQKETI-----DKELDMDSSRFFDSAKNIFLARGHMGAKADFVFAPEQRA--- 264
               :.|:.|.:..:.|::     ....|...|.|         .|||:.|.|:..::  |:|   
Zfish   118 ---SSDRKYCEFKEDESVHVYHRSSNADYKGSGF---------DRGHLAAAANHKWS--QKAMDE 168

  Fly   265 TFLFINAAPQWQTFNAGNWARVEDGVRAWVAKENKHVECWTGVWGVTTLPNKNGEQRQLYLSHDN 329
            ||...|.:||....|...|..:|...|: :.|..::|...|   |...||.:..:.: :|:.:..
Zfish   169 TFYLSNVSPQNPNLNQNAWNNLEKYCRS-LTKHYQNVFVCT---GPLYLPRQEADGK-MYVKYQV 228

  Fly   330 NGNGLIPVPKLYFRVVIEPSTKKGIVLIGVNNPHLSLEE---IKRDYILCTDVSDRINWISW--- 388
            .|...:.||..:|:|||....:..:.|.....|::.::|   ::| :::..:..:|.:.:.:   
Zfish   229 LGKNHVAVPTHFFKVVILEKPRGDVELRSYVMPNMPVDEKIPLER-FLVPIESIERASGLLFVPN 292

  Fly   389 --KKTD----ITAG 396
              |:|.    ||||
Zfish   293 IMKRTSSLKAITAG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3819NP_001262027.1 NUC 164..415 CDD:238043 53/253 (21%)
endogNP_001019385.1 NUC 89..293 CDD:214683 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.