DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG34409

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:273 Identity:58/273 - (21%)
Similarity:104/273 - (38%) Gaps:92/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLS 126
            ::.|:|...::   :..|.|.:||..:|:|:|||.::....:..|.|         ||.|:.| :
  Fly   267 IAYRNRSSSRI---SFRCSGSLISSNHIVTAAHCVVNLVSDLELSHV---------RLGSQDG-A 318

  Fly   127 LNMEVKKIFV-PDKFTVFNTNNIALMMLAKK--------LPLDNP------LVGVI--------- 167
            ....::::.| |:.......|:|||:.:...        ||.:.|      |:|.|         
  Fly   319 TPFAIEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIG 383

  Fly   168 ---NLPTADPE-----------PGLNYT--VLGWGRIFKGGPLASDILHIDVELLPRDICEKKVH 216
               |..:.||.           |.:|.|  .:.:..:       |:.....:.:.|..:|.:.:.
  Fly   384 STENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASL-------SENFQQPIVITPNHLCAQGMP 441

  Fly   217 IFKEEMMCAGNLNNTMDENPCAGDTGSPL-------IFNE----TVFGVVSYRVG---CGSKTLP 267
            :                .:.|.||:|.|.       :|..    |:.|:|::  |   ||..|:|
  Fly   442 M----------------NDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAF--GPTLCGVTTIP 488

  Fly   268 SIYTNVYMHMDWI 280
            .:||.|....|||
  Fly   489 GVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 58/273 (21%)
Tryp_SPc 60..280 CDD:214473 56/271 (21%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 56/271 (21%)
Tryp_SPc 252..501 CDD:238113 56/271 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.