DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and AZU1

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:284 Identity:79/284 - (27%)
Similarity:118/284 - (41%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKL-------FG 74
            |.:|.||..|.|....|           |||..|          :|..|..||.:.       ..
Human     4 LTVLALLAGLLASSRAG-----------SSPLLD----------IVGGRKARPRQFPFLASIQNQ 47

  Fly    75 DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGT----TNRLKSRKGLSLNMEVKKIF 135
            ..|||||.:|...:::|:|.|...:     ...|..||.|.    ....:||:..|::...:..:
Human    48 GRHFCGGALIHARFVMTAASCFQSQ-----NPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGY 107

  Fly   136 VPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLP--TADPEPGLNYTVLGWGRIFKGGPLASDI 198
            .|.:    |.|::.|:.|.::..|.:. |.::.||  .|..|.|....|.|||....||.|:...
Human   108 DPQQ----NLNDLMLLQLDREANLTSS-VTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFP 167

  Fly   199 LHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVG-CG 262
            ..::|.:.|.|.|       :...:|.|.|  |.....|.||.|:||:......||.|:.:| ||
Human   168 RFVNVTVTPEDQC-------RPNNVCTGVL--TRRGGICNGDGGTPLVCEGLAHGVASFSLGPCG 223

  Fly   263 SKTLPSIYTNVYMHMDWINGIMNN 286
            ..  |..:|.|.:..|||:|::||
Human   224 RG--PDFFTRVALFRDWIDGVLNN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 65/236 (28%)
Tryp_SPc 60..280 CDD:214473 63/233 (27%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 64/233 (27%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.