DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and KLK10

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:249 Identity:70/249 - (28%)
Similarity:119/249 - (47%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RSRRPHK--LF-GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLS 126
            |..:|.:  || |.:..|.||::.::::||:|||.         ::.|....| .:.|...:|..
Human    54 RGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCG---------NKPLWARVG-DDHLLLLQGEQ 108

  Fly   127 LNMEVKKIFVPDKF---------TVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTV 182
            |....:.:..| |:         ...:.:::.|:.||:.:.| .|.|..:.||....:||....|
Human   109 LRRTTRSVVHP-KYHQGSGPILPRRTDEHDLMLLKLARPVVL-GPRVRALQLPYRCAQPGDQCQV 171

  Fly   183 LGWG-----RI-FKGGPLASDILHIDVELLPRDICEKKVHIF-----KEEMMCAGNLNNTMD--E 234
            .|||     |: :..|...|.|    ..|.|:: ||    :|     ...|:|||     :|  :
Human   172 AGWGTTAARRVKYNKGLTCSSI----TILSPKE-CE----VFYPGVVTNNMICAG-----LDRGQ 222

  Fly   235 NPCAGDTGSPLIFNETVFGVVSYRV-GCGSKTLPSIYTNVYMHMDWINGIMNNN 287
            :||..|:|.||:.:||:.|::|:.| .|||...|::||.:..:|.|||.::.:|
Human   223 DPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 69/243 (28%)
Tryp_SPc 60..280 CDD:214473 66/240 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 69/243 (28%)
Tryp_SPc 49..269 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.