DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:106/247 - (42%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YVVSIRSRRPHKLF--GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122
            |:|.:       ||  ..|.:|||.||..|::||:|||                    ||   ..
  Fly    51 YIVGL-------LFSGNGNWWCGGSIIGNTWVLTAAHC--------------------TN---GA 85

  Fly   123 KGLSLNMEVKKIFVPDKFT------------VFNTNNIALMMLAKKLPLDN--PLVGVINLPTAD 173
            .|:::|........| ::|            .:|:.|:...:...:.|..:  .||..:.||:.:
  Fly    86 SGVTINYGASLRNQP-QYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVELPSYN 149

  Fly   174 PE----PGLNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEK--KVHIFKEEMMCAGNLNNTM 232
            ..    .|......|||..:.|.||...:..:||:::.:..|.:  .:|   :.|:|   :|...
  Fly   150 DRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRTWSLH---DNMIC---INTNG 208

  Fly   233 DENPCAGDTGSPLIFNE--TVFGVVSY--RVGCGSKTLPSIYTNVYMHMDWI 280
            .::.|.||:|.||:.:|  .:.||.|:  ..||.|.. |::::.|..::|||
  Fly   209 GKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGA-PAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/247 (25%)
Tryp_SPc 60..280 CDD:214473 59/245 (24%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 59/245 (24%)
Tryp_SPc 38..262 CDD:238113 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.