DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG11842

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:243 Identity:57/243 - (23%)
Similarity:107/243 - (44%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFT- 141
            ||||.:||..::||:|||....:..|:.:|:..:...|.|.....:    :.:||......:|: 
  Fly   102 FCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPE----DFDVKDFTAHPEFSY 162

  Fly   142 --VFNTNNIALMMLAKKLPLD---NPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHI 201
              ::  |:|:::.|::.:..:   :|..    ||..|...|.::..:|||::             
  Fly   163 PAIY--NDISVVRLSRPVTFNDYKHPAC----LPFDDGRLGTSFIAIGWGQL------------- 208

  Fly   202 DVELLPRDICEK--KVHIFKEEMMC--AGNLNNTMDE----------------NPCAGDTGSPLI 246
              |::||...:|  ||.::.....|  ..:.|:.:.|                :.|.||:|.|::
  Fly   209 --EIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVL 271

  Fly   247 FNET-------VFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNN 287
            ....       |.|:.|..|.|.:..||::||.|:.::|||...:..|
  Fly   272 IYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLAKN 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 56/237 (24%)
Tryp_SPc 60..280 CDD:214473 54/234 (23%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 56/237 (24%)
Tryp_SPc 73..312 CDD:214473 54/234 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.