DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG10232

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:103/225 - (45%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVP---DKF 140
            |.|.:|::.|:||:|||.: |.|:|:...||..|....:.:.:.............||.   :.|
  Fly   288 CSGSLINKRYVLTAAHCVV-KDKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYF 351

  Fly   141 TV----FNT----NNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNY--TVLGWGRIFKGGPLA 195
            .|    |||    ::|||:.|...:...:.::.:. :| .||.|..|:  .:.||| ..|....:
  Fly   352 NVHEQYFNTSRFESDIALVRLQTPVRYTHEILPIC-VP-KDPIPLHNHPLQIAGWG-YTKNREYS 413

  Fly   196 SDILHIDVELLPRDICEKKVHIFK-EEMMCAGNLNNTMDENPCAGDTGSPLI------FNETVF- 252
            ..:||..| ...|..|:.|:..|: |..:||..:..   |:.|.||:|.||:      :.:.|: 
  Fly   414 QVLLHNTV-YENRYYCQDKISFFRNESQICASGIRG---EDSCEGDSGGPLMLTLNNDYQDIVYL 474

  Fly   253 -GVVSY-RVGCGSKTLPSIYTNVYMHMDWI 280
             |:||| ...||.:. |.:||.......||
  Fly   475 AGIVSYGSENCGDRK-PGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/225 (28%)
Tryp_SPc 60..280 CDD:214473 62/223 (28%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 64/225 (28%)
Tryp_SPc 260..503 CDD:214473 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.