DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and SPE

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:271 Identity:78/271 - (28%)
Similarity:117/271 - (43%) Gaps:70/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LVLAKYVVSIRSRRPHKLFGDNHF--CGGVIISRTYILTSAHC----AMDKR-KIVHRSRVLVVV 112
            :||.:|         .|||.:.:.  |||.:::..|:||:.||    .:||. .::|..|:    
  Fly   149 MVLLQY---------KKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRL---- 200

  Fly   113 AG----------TT----NRLKSRKGLSLNME---VKKIFVPDKFTVFNTNNIALMMLAKKLPLD 160
             |          ||    .|:.:.|.:.:.:|   :.:::.|:  :|...|:|||:.| |::...
  Fly   201 -GEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPN--SVDQRNDIALVRL-KRIVSY 261

  Fly   161 NPLVGVINLPTADPEPGL---NYT-----VLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHI 217
            ...|..|.|||    .||   |:.     |.|||......|.|.. |.|.|.:.....|::|...
  Fly   262 TDYVRPICLPT----DGLVQNNFVDYGMDVAGWGLTENMQPSAIK-LKITVNVWNLTSCQEKYSS 321

  Fly   218 FK----EEMMCAGNLNNTMDENPCAGDTGSPLIF-----NETVF---GVVSYRV-GCGSKTLPSI 269
            ||    :..||||   ..:..:.|.||:|.||:.     ...||   ||.||.. .||.|..|.:
  Fly   322 FKVKLDDSQMCAG---GQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGV 383

  Fly   270 YTNVYMHMDWI 280
            ||.....:|||
  Fly   384 YTRTGAFIDWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 76/266 (29%)
Tryp_SPc 60..280 CDD:214473 74/264 (28%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 78/271 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.