DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG31219

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:249 Identity:60/249 - (24%)
Similarity:99/249 - (39%) Gaps:66/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSL--------------- 127
            ||.|.:|:..|:||||||                |.|....| |.|.:.|               
  Fly   119 FCAGSLINNRYVLTSAHC----------------VNGIPRDL-SLKSVRLGEHDITYDPAYNPDC 166

  Fly   128 ----------NMEVK--KIFVPDKFTVFNTNNIA--LMMLAKKLPLDNPLVGVINLPTADPEPGL 178
                      |:|:|  ||.|...|:..:..||.  :.:|..|:|: ....|:  :|...|:.|.
  Fly   167 RDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPV-RYRTGI--MPICIPKHGF 228

  Fly   179 ----NYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKK---VHIFKEEMMCAGNLNNTMDENP 236
                ...:.|||:. ..|..:..::|..:......:|..:   :.:.:...:|||..:..   :.
  Fly   229 FAKSKLEIAGWGKT-NEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGV---DT 289

  Fly   237 CAGDTGSPLIF---NETVF--GVVSY-RVGCGSKTLPSIYTNVYMHMDWINGIM 284
            |.||:|.||:.   |.:|:  |:.:| ...||...:|.|||.....:.||..::
  Fly   290 CQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/246 (24%)
Tryp_SPc 60..280 CDD:214473 58/243 (24%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 58/243 (24%)
Tryp_SPc 90..342 CDD:238113 60/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.