DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG5255

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:70/284 - (24%)
Similarity:119/284 - (41%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLLPILDAGDPIGSHFVRRRAKR-LSSPYFDK-------EKTLVLAKYVVSIRSRRPHKLFGD 75
            ||:|||::        .|....|.: |..|.:.|       |....||.|.:|::.     :...
  Fly     2 LLILLPLV--------LFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQG-----IGSG 53

  Fly    76 NHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKF 140
            .|.|||.||...:|:|:|||...::....|     |:.||.:         |:....|.:.||:.
  Fly    54 AHSCGGAIIDERWIITAAHCTRGRQATAFR-----VLTGTQD---------LHQNGSKYYYPDRI 104

  Fly   141 TVFNT-------NNIALMMLAKKLPLDNPLVGVINLPTADPE---PGLNYTVLGWGRIFKGGPLA 195
            ...:.       |:|||:.|.:.:..||....|    ..|.|   ||....:.|||.:..||.:.
  Fly   105 VEHSNYAPRKYRNDIALLHLNESIVFDNATQPV----ELDHEALVPGSRLLLTGWGTLSLGGDVP 165

  Fly   196 SDILHIDVELLPRDICEKKVHIFKEEM----MCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVS 256
            :.:..::|..:|.:.| :..|.....:    :|.   .|......|.||:|.||:.|..:..:|:
  Fly   166 ARLQSLEVNYVPFEQC-RAAHDNSTRVDIGHVCT---FNDKGRGACHGDSGGPLVHNGKLVALVN 226

  Fly   257 YRVGCGSKTLPSIYTNVYMHMDWI 280
            :.:.| :|..|..:.::..:.|:|
  Fly   227 WGLPC-AKGYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/235 (24%)
Tryp_SPc 60..280 CDD:214473 56/233 (24%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 59/247 (24%)
Tryp_SPc 30..252 CDD:238113 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.