DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG5246

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:116/250 - (46%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122
            |.|.|||.:     .||: |.|||.||:..:|||:|||      :....:.|.:|.||.:  .:|
  Fly    53 APYQVSIMN-----TFGE-HVCGGSIIAPQWILTAAHC------MEWPIQYLKIVTGTVD--YTR 103

  Fly   123 KGLSLNMEVKKIFVPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTAD--PEPGLNYTVLGW 185
            .|....::..||........:: |:|||:..||.:..|: |...|.|.:..  |:.|...|:.||
  Fly   104 PGAEYLVDGSKIHCSHDKPAYH-NDIALIHTAKPIVYDD-LTQPIKLASKGSLPKVGDKLTLTGW 166

  Fly   186 GRIFKGGPLASDILHIDVELLPRDICEKKV---------HI--FKEEMMCAGNLNNTMDENPCAG 239
            |.....|..::.:..||:..:..|.|:.:|         |:  |.:|           .|..|.|
  Fly   167 GSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQE-----------GEGSCHG 220

  Fly   240 DTGSPLI-FNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNNEANRLC 293
            |:|.||: .|:|:.|||::...| :...|.::.:|..:.|||..:|  .:|...|
  Fly   221 DSGGPLVDANQTLVGVVNWGEAC-AIGYPDVFGSVAYYHDWIEQMM--TDAGTAC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 69/236 (29%)
Tryp_SPc 60..280 CDD:214473 67/233 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/235 (29%)
Tryp_SPc 42..263 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.