DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG4053

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:121/297 - (40%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFDKEKTL------------VLAKYVVSIRSRR 68
            |::||||...:|.          .|.|||     |..|.|            .:|.|.|||::  
  Fly     7 LIWLLLLGTSIDV----------TRGKRL-----DNRKLLDNRIVGGQEAEDGVAPYQVSIQT-- 54

  Fly    69 PHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKK 133
                ....|.|.|||::..:|||:.|||:|     .....|.::.||.:||          |..:
  Fly    55 ----IWKTHICSGVILNEQWILTAGHCALD-----FSIEDLRIIVGTNDRL----------EPGQ 100

  Fly   134 IFVPDKFT---------VFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIF 189
            ...||:..         |:| |:|||:.:.:.: :.|....::.|....|..|...|:.|||...
  Fly   101 TLFPDEALVHCLYDIPYVYN-NDIALIHVNESI-IFNDRTQIVELSREQPPAGSTVTLTGWGAPE 163

  Fly   190 KGGPLASDILHIDVELLPRDICEKK---------VHI--FKEEMMCAGNLNNTMDENPCAGDTGS 243
            ...|....:..:::.::..:.|.::         .||  |..|           .|..|:||:|.
  Fly   164 SSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTRE-----------GEGACSGDSGG 217

  Fly   244 PLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWI 280
            ||::...:.|:|::...|| ..:|.:|.|...:.|||
  Fly   218 PLMWEGKLVGLVNWGRACG-VGMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/241 (25%)
Tryp_SPc 60..280 CDD:214473 59/239 (25%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 60/253 (24%)
Tryp_SPc 35..256 CDD:238113 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.