DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and CG17475

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:105/264 - (39%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 AKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122
            |||.:|::.     ::| .|.|||.||...::||:|||...     :....|.|:.||       
  Fly    61 AKYQISLQG-----MYG-GHICGGCIIDERHVLTAAHCVYG-----YNPTYLRVITGT------- 107

  Fly   123 KGLSLNMEVKK----IFVPDKFTVFN------TNNIALMMLAKKLPLDNPLVGVINLPTADPEPG 177
                  :|.:|    .||.:.:...|      .|:|||:.|...:.. |.......||||....|
  Fly   108 ------VEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKF-NEYTQPAELPTAPVANG 165

  Fly   178 LNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENP------ 236
            ....:.|||.....|...             ||.:|..........|...:||.....|      
  Fly   166 TQLLLTGWGSTELWGDTP-------------DILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTL 217

  Fly   237 -------CAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNNEANRLCY 294
                   |.||:|.||..|..::|:|::...| :..:|..:.|||.:::||..:::...:|..||
  Fly   218 TTGGQGACHGDSGGPLTHNGVLYGLVNWGYPC-ALGVPDSHANVYYYLEWIRSMISGPCSNCHCY 281

  Fly   295 SPNY 298
            :.||
  Fly   282 ASNY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/245 (25%)
Tryp_SPc 60..280 CDD:214473 59/242 (24%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/244 (25%)
Tryp_SPc 50..269 CDD:238113 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.