DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18223 and modSP

DIOPT Version :9

Sequence 1:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:255 Identity:52/255 - (20%)
Similarity:96/255 - (37%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DNHF-CGGVIISRTYILTSAHCAMDK-RKIVHRSRVLVVVA-------GTTNRLKSRKGLSLNME 130
            |.|| |||.:::...::|:|||..|: .::.:......|:|       |.|...:.|:      :
  Fly   394 DYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRR------D 452

  Fly   131 VKKIFVPDKFTVFNTN---NIALMMLAKKLPLDNPL--VGVINLPTADPE---PGLNYTVLGWGR 187
            |:.|.:...:.....|   ::||:.|.:...|.:.:  :.|.....|:.|   ..:.....||..
  Fly   453 VRLIEIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNI 517

  Fly   188 IFKGGPLASDILHIDVELLP-----RDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTG----S 243
            ..|         | :::.:|     ..:|.:.:...:.:..|......::   .|.||:|    |
  Fly   518 ENK---------H-ELQFVPAVSKSNSVCRRNLRDIQADKFCIFTQGKSL---ACQGDSGGGFTS 569

  Fly   244 PLIFN---------ETVFGVVSYRVG---CGSKTLPSIYTNVYMHMDWINGIMNNNEANR 291
            .|..|         ..:|||:|....   |....  ::.||:....|.|...||.:...|
  Fly   570 ELPTNAFSTWNTARHFLFGVISNAPNADQCAHSL--TVMTNIQHFEDMILNAMNRSVETR 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 49/245 (20%)
Tryp_SPc 60..280 CDD:214473 48/242 (20%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 48/242 (20%)
Tryp_SPc 371..591 CDD:304450 43/215 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.